Crystal structure of rhodostomin argdp mutant
PDB DOI: 10.2210/pdb4m4c/pdb
Classification: TOXIN Organism(s): Calloselasma Rhodostoma
Deposited: 2013-08-07 Deposition Author(s): Chang, Y.T. , Chen, C.Y. , Chuang, W.J. , Jeng, W.Y. , Shiu, J.H.
Crystal structure of rhodostomin argdp mutant
Chang, Y.T. , Chen, C.Y. , Chuang, W.J. , Jeng, W.Y. , Shiu, J.H.
Primary Citation of Related Structures: 4M4C
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc metalloproteinase/disintegrin | A | 68 | Calloselasma Rhodostoma | GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDPPDDRCTGQSADCPRYH |
| Zinc metalloproteinase/disintegrin | B | 68 | Calloselasma Rhodostoma | GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDPPDDRCTGQSADCPRYH |
| Zinc metalloproteinase/disintegrin | C | 68 | Calloselasma Rhodostoma | GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDPPDDRCTGQSADCPRYH |
| Zinc metalloproteinase/disintegrin | D | 68 | Calloselasma Rhodostoma | GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDPPDDRCTGQSADCPRYH |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-08-07 Deposition Author(s): Chang, Y.T. , Chen, C.Y. , Chuang, W.J. , Jeng, W.Y. , Shiu, J.H.