Structure of a single-domain camelid antibody fragment cab-h7s specific of the blap beta-lactamase from bacillus licheniformis
PDB DOI: 10.2210/pdb4m3j/pdb
Classification: IMMUNE SYSTEM Organism(s): Lama Glama
Deposited: 2013-08-06 Deposition Author(s): Charlier, P. , Dumoulin, M. , Herman, R. , Kerff, F. , Pain, C. , Preumont, S. , Sauvage, E.
Structure of a single-domain camelid antibody fragment cab-h7s specific of the blap beta-lactamase from bacillus licheniformis
Charlier, P. , Dumoulin, M. , Herman, R. , Kerff, F. , Pain, C. , Preumont, S. , Sauvage, E.
Primary Citation of Related Structures: 4M3J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Camelid heavy-chain antibody variable fragment cAb-H7S | A | 126 | Lama Glama | QVQLQESGGGLVQPGGSLRLSCAASGSISSITTMGWYRQDPGKGRELVALINSVGDTTYAGSVKGRFTISRDNAKNTVYLEMSSLKPEDTAVYYCNAFMSTNSGRTGSFWGQGTQVTVSSHHHHHH |
| Camelid heavy-chain antibody variable fragment cAb-H7S | B | 126 | Lama Glama | QVQLQESGGGLVQPGGSLRLSCAASGSISSITTMGWYRQDPGKGRELVALINSVGDTTYAGSVKGRFTISRDNAKNTVYLEMSSLKPEDTAVYYCNAFMSTNSGRTGSFWGQGTQVTVSSHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-08-06 Deposition Author(s): Charlier, P. , Dumoulin, M. , Herman, R. , Kerff, F. , Pain, C. , Preumont, S. , Sauvage, E.