Rapid and efficient design of new inhibitors of mycobacterium tuberculosis transcriptional repressor ethr using fragment growing, merging and linking approaches
PDB DOI: 10.2210/pdb4m3f/pdb
Classification: TRANSCRIPTION REPRESSOR/INHIBITOR Organism(s): Mycobacterium Tuberculosis
Deposited: 2013-08-06 Deposition Author(s): Baulard, A. , Blondiaux, N. , Brodin, P. , Crauste, C. , Deprez, B. , Flipo, M. , Leroux, F. , Malaquin, S. , Piveteau, C. , Sperandio, O. , Villemagne, B. , Villeret, V. , Villoutreix, B. , Willand, N. , Wintjens, R. , Wohlkonig, A.
Rapid and efficient design of new inhibitors of mycobacterium tuberculosis transcriptional repressor ethr using fragment growing, merging and linking approaches
Baulard, A. , Blondiaux, N. , Brodin, P. , Crauste, C. , Deprez, B. , Flipo, M. , Leroux, F. , Malaquin, S. , Piveteau, C. , Sperandio, O. , Villemagne, B. , Villeret, V. , Villoutreix, B. , Willand, N. , Wintjens, R. , Wohlkonig, A.
Primary Citation of Related Structures: 4M3F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HTH-type transcriptional regulator EthR | A | 216 | Mycobacterium Tuberculosis | MTTSAASQASLPRGRRTARPSGDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGENR |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-08-06 Deposition Author(s): Baulard, A. , Blondiaux, N. , Brodin, P. , Crauste, C. , Deprez, B. , Flipo, M. , Leroux, F. , Malaquin, S. , Piveteau, C. , Sperandio, O. , Villemagne, B. , Villeret, V. , Villoutreix, B. , Willand, N. , Wintjens, R. , Wohlkonig, A.