High resolution x-ray crystal structure of l-shk toxin
PDB DOI: 10.2210/pdb4lfq/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2013-06-27 Deposition Author(s): Bezanilla, F. , Dang, B. , Kent, S.B.H. , Kubota, T. , Mandal, K.
High resolution x-ray crystal structure of l-shk toxin
Bezanilla, F. , Dang, B. , Kent, S.B.H. , Kubota, T. , Mandal, K.
Primary Citation of Related Structures: 4LFQ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Potassium channel toxin ShK | A | 35 | N.A. | RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-06-27 Deposition Author(s): Bezanilla, F. , Dang, B. , Kent, S.B.H. , Kubota, T. , Mandal, K.