Crystal structure of the pkd1 domain from vibrio cholerae metalloprotease prtv
PDB DOI: 10.2210/pdb4l9d/pdb
Classification: CELL ADHESION Organism(s): Vibrio Cholerae
Deposited: 2013-06-18 Deposition Author(s): Edwin, A. , Sauer-Eriksson, A.E. , Stier, G.
Crystal structure of the pkd1 domain from vibrio cholerae metalloprotease prtv
Edwin, A. , Sauer-Eriksson, A.E. , Stier, G.
Primary Citation of Related Structures: 4L9D
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 88 | Vibrio Cholerae | GAMENIAPVARFELKVEGLSVMSQNTSSDSDGNIVSYLWDFGNGQTSTEAAPTWSYTKAGSYSVTLTVTDDKGDSDTHQQTIKVDTPN |
| Protease | B | 88 | Vibrio Cholerae | GAMENIAPVARFELKVEGLSVMSQNTSSDSDGNIVSYLWDFGNGQTSTEAAPTWSYTKAGSYSVTLTVTDDKGDSDTHQQTIKVDTPN |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-06-18 Deposition Author(s): Edwin, A. , Sauer-Eriksson, A.E. , Stier, G.