Backbone modifications in the protein gb1 loops: beta-3-val21, beta-3-asp40
PDB DOI: 10.2210/pdb4kgs/pdb
Classification: DE NOVO PROTEIN Organism(s): N.A.
Deposited: 2013-04-29 Deposition Author(s): Horne, W.S. , Lengyel, G.A. , Reinert, Z.E.
Method: X-RAY DIFFRACTION Resolution: 1.95 Å
Backbone modifications in the protein gb1 loops: beta-3-val21, beta-3-asp40
Horne, W.S. , Lengyel, G.A. , Reinert, Z.E.
Primary Citation of Related Structures: 4KGS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Streptococcal Protein GB1 Backbone Modified Variant: beta-3-Val21, beta-3-Asp40 | A | 57 | N.A. | DTYKLILNGKTLKGETTTEAXDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEX |
| Streptococcal Protein GB1 Backbone Modified Variant: beta-3-Val21, beta-3-Asp40 | B | 57 | N.A. | DTYKLILNGKTLKGETTTEAXDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEX |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-04-29 Deposition Author(s): Horne, W.S. , Lengyel, G.A. , Reinert, Z.E.