Cftr associated ligand (cal) e317a pdz domain bound to peptide ical36-qdtrl (ansrwqdtrl)
PDB DOI: 10.2210/pdb4k78/pdb
Classification: PEPTIDE BINDING PROTEIN/PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-04-16 Deposition Author(s): Amacher, J.F. , Madden, D.R.
Cftr associated ligand (cal) e317a pdz domain bound to peptide ical36-qdtrl (ansrwqdtrl)
Primary Citation of Related Structures: 4K78
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISAIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| iCAL36-QDTRL peptide | B | 10 | Homo Sapiens , Synthetic Construct | ANSRWQDTRL |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-04-16 Deposition Author(s): Amacher, J.F. , Madden, D.R.