PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

4K76

Cftr associated ligand (cal) pdz domain bound to peptide ical36-trl (ansrwpttrl)

PDB DOI: 10.2210/pdb4k76/pdb

Classification: PEPTIDE BINDING PROTEIN/PROTEIN BINDING
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2013-04-16
Deposition Author(s): Amacher, J.F. , Madden, D.R.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.75 Å

4k76
Literature

Cftr associated ligand (cal) pdz domain bound to peptide ical36-trl (ansrwpttrl)

Amacher, J.F. , Madden, D.R.

Primary Citation of Related Structures: 4K76


Proteins
Molecule Chains Sequence Length Organism Sequence
Golgi-associated PDZ and coiled-coil motif-containing protein A 87 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Golgi-associated PDZ and coiled-coil motif-containing protein B 87 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Golgi-associated PDZ and coiled-coil motif-containing protein C 87 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Golgi-associated PDZ and coiled-coil motif-containing protein D 87 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
iCAL36-TRL peptide E 10 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) ANSRWPTTRL
iCAL36-TRL peptide F 10 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) ANSRWPTTRL
iCAL36-TRL peptide G 10 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) ANSRWPTTRL
iCAL36-TRL peptide H 10 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) ANSRWPTTRL
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2013-04-16
Deposition Author(s): Amacher, J.F. , Madden, D.R.