4K76
Cftr associated ligand (cal) pdz domain bound to peptide ical36-trl (ansrwpttrl)
PDB DOI: 10.2210/pdb4k76/pdb
Classification: PEPTIDE BINDING PROTEIN/PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-04-16 Deposition Author(s): Amacher, J.F. , Madden, D.R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.75 Å
Cftr associated ligand (cal) pdz domain bound to peptide ical36-trl (ansrwpttrl)
Primary Citation of Related Structures: 4K76
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| Golgi-associated PDZ and coiled-coil motif-containing protein | C | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| Golgi-associated PDZ and coiled-coil motif-containing protein | D | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| iCAL36-TRL peptide | E | 10 | Homo Sapiens , Synthetic Construct | ANSRWPTTRL |
| iCAL36-TRL peptide | F | 10 | Homo Sapiens , Synthetic Construct | ANSRWPTTRL |
| iCAL36-TRL peptide | G | 10 | Homo Sapiens , Synthetic Construct | ANSRWPTTRL |
| iCAL36-TRL peptide | H | 10 | Homo Sapiens , Synthetic Construct | ANSRWPTTRL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2013-04-16 Deposition Author(s): Amacher, J.F. , Madden, D.R.