Cftr associated ligand (cal) pdz domain bound to peptide a-ical36 (ansraptsii)
PDB DOI: 10.2210/pdb4joe/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-03-18 Deposition Author(s): Amacher, J.F. , Madden, D.R.
Cftr associated ligand (cal) pdz domain bound to peptide a-ical36 (ansraptsii)
Primary Citation of Related Structures: 4JOE
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
A-iCAL36 peptide | C | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ANSRAPTSII |
A-iCAL36 peptide | D | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ANSRAPTSII |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-03-18 Deposition Author(s): Amacher, J.F. , Madden, D.R.