Crystal structure of thiol peroxidase from burkholderia cenocepacia j2315
PDB DOI: 10.2210/pdb4je1/pdb
Classification: OXIDOREDUCTASE Organism(s): Burkholderia Cenocepacia
Deposited: 2013-02-26 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of thiol peroxidase from burkholderia cenocepacia j2315
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 4JE1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Probable thiol peroxidase | A | 175 | Burkholderia Cenocepacia | MAHHHHHHMSKVTLGGNPIDLAGTFPAVGAQAADFKLVGKDLADLSLASFAGKRKVLNIVPSLDTPTCATSTRKFNEAASSLDNTVVIVVSADLPFAATRFCTTEGLANVVTASTFRTGRAFANAYGVDVTSGPLNGLTARAVVVLDAQDKVIHAELVGEIKDEPNYDAALAALK |
| Probable thiol peroxidase | B | 175 | Burkholderia Cenocepacia | MAHHHHHHMSKVTLGGNPIDLAGTFPAVGAQAADFKLVGKDLADLSLASFAGKRKVLNIVPSLDTPTCATSTRKFNEAASSLDNTVVIVVSADLPFAATRFCTTEGLANVVTASTFRTGRAFANAYGVDVTSGPLNGLTARAVVVLDAQDKVIHAELVGEIKDEPNYDAALAALK |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-02-26 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)