Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron vpi-5482, target efi-501083, with bound sodium and glycerol, closed lid, ordered loop
PDB DOI: 10.2210/pdb4jb3/pdb
Classification: HYDROLASE Organism(s): Bacteroides Thetaiotaomicron
Deposited: 2013-02-19 Deposition Author(s): Al Obaidi, N.F. , Allen, K.N. , Almo, S.C. , Bhosle, R. , Chowdhury, S. , Dunaway-Mariano, D. , Enzyme Function Initiative (Efi) , Evans, B. , Gerlt, J.A. , Ghosh, A. , Hammonds, J. , Hillerich, B. , Imker, H.J. , Kumar, P.R. , Love, J. , Scott Glenn, A. , Seidel, R.D. , Stead, M. , Toro, R. , Vetting, M.W. , Washington, E.
Crystal structure of bt_0970, a had family phosphatase from bacteroides thetaiotaomicron vpi-5482, target efi-501083, with bound sodium and glycerol, closed lid, ordered loop
Al Obaidi, N.F. , Allen, K.N. , Almo, S.C. , Bhosle, R. , Chowdhury, S. , Dunaway-Mariano, D. , Enzyme Function Initiative (Efi) , Evans, B. , Gerlt, J.A. , Ghosh, A. , Hammonds, J. , Hillerich, B. , Imker, H.J. , Kumar, P.R. , Love, J. , Scott Glenn, A. , Seidel, R.D. , Stead, M. , Toro, R. , Vetting, M.W. , Washington, E.
Primary Citation of Related Structures: 4JB3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Haloacid dehalogenase-like hydrolase | A | 228 | Bacteroides Thetaiotaomicron | MHHHHHHSSGVDLGTENLYFQSMIKNIVFDFGGVIVDIDRDKAVQAFIKLGLADADTRLDKYHQTGIFQELEEGKLSADEFRKQLGDLCGRELTMEETKQAWLGFFNEVDLRKLDYILGLRKSYHVYLLSNTNPFVMSWACSPEFSSEGKPLNDYCDKLYLSYQLGHTKPAPEIFDFMIKDSHVIPSETLFVDDGSSNIHIGKELGFETFQPENGADWRQELTVILNS |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-02-19 Deposition Author(s): Al Obaidi, N.F. , Allen, K.N. , Almo, S.C. , Bhosle, R. , Chowdhury, S. , Dunaway-Mariano, D. , Enzyme Function Initiative (Efi) , Evans, B. , Gerlt, J.A. , Ghosh, A. , Hammonds, J. , Hillerich, B. , Imker, H.J. , Kumar, P.R. , Love, J. , Scott Glenn, A. , Seidel, R.D. , Stead, M. , Toro, R. , Vetting, M.W. , Washington, E.