Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p17
PDB DOI: 10.2210/pdb4j9i/pdb
Classification: Transferase/unknown function Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-02-16 Deposition Author(s): Camara-Artigas, A.
Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p17
Primary Citation of Related Structures: 4J9I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tyrosine-protein kinase ABL1 | A | 63 | Homo Sapiens , Synthetic Construct | MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS |
| Tyrosine-protein kinase ABL1 | C | 63 | Homo Sapiens , Synthetic Construct | MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS |
| Tyrosine-protein kinase ABL1 | E | 63 | Homo Sapiens , Synthetic Construct | MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS |
| P17 | B | 11 | Homo Sapiens , Synthetic Construct | XAPTYSPPLPP |
| P17 | D | 11 | Homo Sapiens , Synthetic Construct | XAPTYSPPLPP |
| P17 | F | 11 | Homo Sapiens , Synthetic Construct | XAPTYSPPLPP |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-02-16 Deposition Author(s): Camara-Artigas, A.