Thermus thermophilus dnaj j- and g/f-domains
PDB DOI: 10.2210/pdb4j7z/pdb
Classification: CHAPERONE Organism(s): Thermus Thermophilus
Deposited: 2013-02-14 Deposition Author(s): Barends, T.R.M. , Bittl, R. , Brosi, R.W. , Eschenbach, J. , Hartmann, E. , Lorenz, T. , Reinstein, J. , Scherer, A. , Schlichting, I. , Seidel, R. , Shoeman, R. , Steinmetz, A. , Zimmermann, S.
Method: X-RAY DIFFRACTION, EPR Resolution: 1.64 Å
Thermus thermophilus dnaj j- and g/f-domains
Barends, T.R.M. , Bittl, R. , Brosi, R.W. , Eschenbach, J. , Hartmann, E. , Lorenz, T. , Reinstein, J. , Scherer, A. , Schlichting, I. , Seidel, R. , Shoeman, R. , Steinmetz, A. , Zimmermann, S.
Primary Citation of Related Structures: 4J7Z
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chaperone protein DnaJ 2 | A | 113 | Thermus Thermophilus | AAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVLSDPEKRRIYDTYGTTEAPPPPPPGGYDFSGFDVEDFSEFFQELFGPGLFGGFGRRSR |
| Chaperone protein DnaJ 2 | B | 113 | Thermus Thermophilus | AAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVLSDPEKRRIYDTYGTTEAPPPPPPGGYDFSGFDVEDFSEFFQELFGPGLFGGFGRRSR |
| Chaperone protein DnaJ 2 | C | 113 | Thermus Thermophilus | AAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVLSDPEKRRIYDTYGTTEAPPPPPPGGYDFSGFDVEDFSEFFQELFGPGLFGGFGRRSR |
| Chaperone protein DnaJ 2 | D | 113 | Thermus Thermophilus | AAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVLSDPEKRRIYDTYGTTEAPPPPPPGGYDFSGFDVEDFSEFFQELFGPGLFGGFGRRSR |
| Chaperone protein DnaJ 2 | E | 113 | Thermus Thermophilus | AAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVLSDPEKRRIYDTYGTTEAPPPPPPGGYDFSGFDVEDFSEFFQELFGPGLFGGFGRRSR |
| Chaperone protein DnaJ 2 | F | 113 | Thermus Thermophilus | AAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVLSDPEKRRIYDTYGTTEAPPPPPPGGYDFSGFDVEDFSEFFQELFGPGLFGGFGRRSR |
Method: X-RAY DIFFRACTION, EPR
Deposited Date: 2013-02-14 Deposition Author(s): Barends, T.R.M. , Bittl, R. , Brosi, R.W. , Eschenbach, J. , Hartmann, E. , Lorenz, T. , Reinstein, J. , Scherer, A. , Schlichting, I. , Seidel, R. , Shoeman, R. , Steinmetz, A. , Zimmermann, S.