The 1.63a crystal structure of humanized xenopus mdm2 with a nutlin fragment, ro5524529
PDB DOI: 10.2210/pdb4j7e/pdb
Classification: LIGASE/ANTAGONIST Organism(s): Xenopus Laevis
Deposited: 2013-02-13 Deposition Author(s): Graves, B. , Janson, C. , Lukacs, C.
The 1.63a crystal structure of humanized xenopus mdm2 with a nutlin fragment, ro5524529
Graves, B. , Janson, C. , Lukacs, C.
Primary Citation of Related Structures: 4J7E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase Mdm2 | A | 86 | Xenopus Laevis | MEKLVQPTPLLLSLLKSAGAQKETFTMKEVLYHLGQYIMAKQLYDEKQQHIVHCSNDPLGELFGVQEFSVKEHRRIYAMISRNLVS |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-02-13 Deposition Author(s): Graves, B. , Janson, C. , Lukacs, C.