4IIM
Crystal structure of the second sh3 domain of itsn1 bound with a synthetic peptide
PDB DOI: 10.2210/pdb4iim/pdb
Classification: ENDOCYTOSIS Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-12-20 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Gu, J. , Guan, X. , Huang, H. , Sidhu, S. , Structural Genomics Consortium (Sgc) , Tong, Y. , Wernimont, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Crystal structure of the second sh3 domain of itsn1 bound with a synthetic peptide
Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Gu, J. , Guan, X. , Huang, H. , Sidhu, S. , Structural Genomics Consortium (Sgc) , Tong, Y. , Wernimont, A.
Primary Citation of Related Structures: 4IIM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Intersectin-1 | A | 70 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAAQPAMAQGALLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISAAA |
| Intersectin-1 | B | 70 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAAQPAMAQGALLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISAAA |
| peptide ligand | C | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | WRDSSGYVMGPW |
| peptide ligand | D | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | WRDSSGYVMGPW |
| peptide ligand | E | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | WRDSSGYVMGPW |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2012-12-20 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Gu, J. , Guan, X. , Huang, H. , Sidhu, S. , Structural Genomics Consortium (Sgc) , Tong, Y. , Wernimont, A.