Polycrystalline t6 bovine insulin: anisotropic lattice evolution and novel structure refinement strategy
PDB DOI: 10.2210/pdb4idw/pdb
Classification: HORMONE Organism(s): Bos Taurus
Deposited: 2012-12-13 Deposition Author(s): Fitch, A. , Giannopoulou, A.E. , Knight, L. , Margiolaki, I. , Norrman, M. , Schluckebier, G. , Von Dreele, R.B. , Wright, J.P.
Method: POWDER DIFFRACTION
Polycrystalline t6 bovine insulin: anisotropic lattice evolution and novel structure refinement strategy
Fitch, A. , Giannopoulou, A.E. , Knight, L. , Margiolaki, I. , Norrman, M. , Schluckebier, G. , Von Dreele, R.B. , Wright, J.P.
Primary Citation of Related Structures: 4IDW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A chain | A | 21 | Bos Taurus | GIVEQCCASVCSLYQLENYCN |
Insulin A chain | C | 21 | Bos Taurus | GIVEQCCASVCSLYQLENYCN |
Insulin B chain | B | 30 | Bos Taurus | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Insulin B chain | D | 30 | Bos Taurus | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Method: POWDER DIFFRACTION
Deposited Date: 2012-12-13 Deposition Author(s): Fitch, A. , Giannopoulou, A.E. , Knight, L. , Margiolaki, I. , Norrman, M. , Schluckebier, G. , Von Dreele, R.B. , Wright, J.P.