Crystal structure of the ig-c2 type 1 domain from mouse fibroblast growth factor receptor 2 (fgfr2) [nysgrc-005912]
PDB DOI: 10.2210/pdb4hwu/pdb
Classification: IMMUNE SYSTEM Organism(s): Mus Musculus
Deposited: 2012-11-08 Deposition Author(s): Ahmed, M. , Almo, S.C. , Atoms-To-Animals: The Immune Function Network (Ifn) , Banu, R. , Bhosle, R. , Calarese, D. , Celikigil, A. , Chamala, S. , Chan, M.K. , Chowdhury, S. , Fiser, A. , Garforth, S. , Glenn, A.S. , Hillerich, B. , Khafizov, K. , Kumar, P.R. , Love, J. , Nathenson, S.G. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Rubinstein, R. , Seidel, R. , Stead, M. , Toro, R.
Crystal structure of the ig-c2 type 1 domain from mouse fibroblast growth factor receptor 2 (fgfr2) [nysgrc-005912]
Ahmed, M. , Almo, S.C. , Atoms-To-Animals: The Immune Function Network (Ifn) , Banu, R. , Bhosle, R. , Calarese, D. , Celikigil, A. , Chamala, S. , Chan, M.K. , Chowdhury, S. , Fiser, A. , Garforth, S. , Glenn, A.S. , Hillerich, B. , Khafizov, K. , Kumar, P.R. , Love, J. , Nathenson, S.G. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Rubinstein, R. , Seidel, R. , Stead, M. , Toro, R.
Primary Citation of Related Structures: 4HWU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fibroblast growth factor receptor 2 | A | 95 | Mus Musculus | QDYGGSQPEAYVVAPGESLELQCMLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTAARTVDSETWIFMVNVTDAAENLYFQ |
| Fibroblast growth factor receptor 2 | B | 95 | Mus Musculus | QDYGGSQPEAYVVAPGESLELQCMLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTAARTVDSETWIFMVNVTDAAENLYFQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-11-08 Deposition Author(s): Ahmed, M. , Almo, S.C. , Atoms-To-Animals: The Immune Function Network (Ifn) , Banu, R. , Bhosle, R. , Calarese, D. , Celikigil, A. , Chamala, S. , Chan, M.K. , Chowdhury, S. , Fiser, A. , Garforth, S. , Glenn, A.S. , Hillerich, B. , Khafizov, K. , Kumar, P.R. , Love, J. , Nathenson, S.G. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Rubinstein, R. , Seidel, R. , Stead, M. , Toro, R.