Crystal structure of the t98e c-src-sh3 domain mutant in complex with the high affinity peptide app12
PDB DOI: 10.2210/pdb4hvv/pdb
Classification: Signaling Protein/Peptide Organism(s): Gallus Gallus , Synthetic Construct
Deposited: 2012-11-07 Deposition Author(s): Camara-Artigas, A.
Crystal structure of the t98e c-src-sh3 domain mutant in complex with the high affinity peptide app12
Primary Citation of Related Structures: 4HVV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 60 | Gallus Gallus , Synthetic Construct | GSHMTFVALYDYESRTEEDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS |
| SYNTHETIC PEPTIDE Acetyl-APPLPPRNRP | B | 11 | Gallus Gallus , Synthetic Construct | XAPPLPPRNRP |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-11-07 Deposition Author(s): Camara-Artigas, A.