4HVV
Crystal structure of the t98e c-src-sh3 domain mutant in complex with the high affinity peptide app12
PDB DOI: 10.2210/pdb4hvv/pdb
Classification: Signaling Protein/Peptide Organism(s): Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-11-07 Deposition Author(s): Camara-Artigas, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.1 Å
Crystal structure of the t98e c-src-sh3 domain mutant in complex with the high affinity peptide app12
Primary Citation of Related Structures: 4HVV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 60 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMTFVALYDYESRTEEDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS |
| SYNTHETIC PEPTIDE Acetyl-APPLPPRNRP | B | 11 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XAPPLPPRNRP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2012-11-07 Deposition Author(s): Camara-Artigas, A.