Crystal structure of human mst2 sarah domain
PDB DOI: 10.2210/pdb4hkd/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica
Deposited: 2012-10-15 Deposition Author(s): Liu, G.G. , Shi, Z.B. , Zhou, Z.C.
Crystal structure of human mst2 sarah domain
Liu, G.G. , Shi, Z.B. , Zhou, Z.C.
Primary Citation of Related Structures: 4HKD
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Serine/threonine-protein kinase 3 | A | 53 | Salmonella Enterica | GAMDDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAK |
Serine/threonine-protein kinase 3 | B | 53 | Salmonella Enterica | GAMDDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAK |
Serine/threonine-protein kinase 3 | C | 53 | Salmonella Enterica | GAMDDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAK |
Serine/threonine-protein kinase 3 | D | 53 | Salmonella Enterica | GAMDDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAK |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-10-15 Deposition Author(s): Liu, G.G. , Shi, Z.B. , Zhou, Z.C.