Crystal structure of the pseudomonas aeruginosa azurin, ruh107no yoh109
PDB DOI: 10.2210/pdb4hhg/pdb
Classification: ELECTRON TRANSPORT Organism(s): Pseudomonas Aeruginosa
Deposited: 2012-10-09 Deposition Author(s): Gray, H.B. , Herrera, N. , Warren, J.J.
Crystal structure of the pseudomonas aeruginosa azurin, ruh107no yoh109
Gray, H.B. , Herrera, N. , Warren, J.J.
Primary Citation of Related Structures: 4HHG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Azurin | A | 128 | Pseudomonas Aeruginosa | AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEEEHFYFFCTFPGHSALMKGTLTLK |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-10-09 Deposition Author(s): Gray, H.B. , Herrera, N. , Warren, J.J.