Crystal structure of the selenomethionine variant of the c-terminal domain of geobacillus thermoleovorans putative u32 peptidase
PDB DOI: 10.2210/pdb4he5/pdb
Classification: UNKNOWN FUNCTION Organism(s): Geobacillus Thermoleovorans
Deposited: 2012-10-03 Deposition Author(s): Arolas, J.L. , Chruszcz, M. , Domagalski, M.J. , Gomis-Ruth, F.X. , Jasilionis, A. , Kuisiene, N. , Minor, W. , Sola, M. , Trillo-Muyo, S.
Crystal structure of the selenomethionine variant of the c-terminal domain of geobacillus thermoleovorans putative u32 peptidase
Arolas, J.L. , Chruszcz, M. , Domagalski, M.J. , Gomis-Ruth, F.X. , Jasilionis, A. , Kuisiene, N. , Minor, W. , Sola, M. , Trillo-Muyo, S.
Primary Citation of Related Structures: 4HE5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidase family U32 | A | 89 | Geobacillus Thermoleovorans | SLKTTREFAGLVLGYDPETGIATVQQRNHFRPGDEVEFFGPEIENFTQVIEKIWDEDGNELDAARHPLQIVKFKVKRPLFPYNMMRKEN |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-10-03 Deposition Author(s): Arolas, J.L. , Chruszcz, M. , Domagalski, M.J. , Gomis-Ruth, F.X. , Jasilionis, A. , Kuisiene, N. , Minor, W. , Sola, M. , Trillo-Muyo, S.