Crystal structure of s. pombe atl1 in complex with damaged dna containing 2,6-diaminopurine
PDB DOI: 10.2210/pdb4hdv/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Conus Stercusmuscarum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-10-02 Deposition Author(s): Tainer, J.A. , Tubbs, J.L.
Crystal structure of s. pombe atl1 in complex with damaged dna containing 2,6-diaminopurine
Primary Citation of Related Structures: 4HDV
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Alkyltransferase-like protein 1 | A | 116 | Conus Stercusmuscarum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKPGSHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-10-02 Deposition Author(s): Tainer, J.A. , Tubbs, J.L.