The von willebrand factor a3 domain binding region of type iii collagen stabilized by the cysteine knot
PDB DOI: 10.2210/pdb4gyx/pdb
Classification: STRUCTURAL PROTEIN, BLOOD CLOTTING Organism(s): N.A.
Deposited: 2012-09-05 Deposition Author(s): Bachinger, H.P. , Boudko, S.P.
The von willebrand factor a3 domain binding region of type iii collagen stabilized by the cysteine knot
Bachinger, H.P. , Boudko, S.P.
Primary Citation of Related Structures: 4GYX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Type III collagen fragment in a host peptide stabilized by the cysteine knot | A | 31 | N.A. | GPPGPPGPRGQPGVMGFPGPPGPPGPCCGGV |
| Type III collagen fragment in a host peptide stabilized by the cysteine knot | B | 31 | N.A. | GPPGPPGPRGQPGVMGFPGPPGPPGPCCGGV |
| Type III collagen fragment in a host peptide stabilized by the cysteine knot | C | 31 | N.A. | GPPGPPGPRGQPGVMGFPGPPGPPGPCCGGV |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-09-05 Deposition Author(s): Bachinger, H.P. , Boudko, S.P.