4GYE
Mdr 769 hiv-1 protease in complex with reduced p1f
PDB DOI: 10.2210/pdb4gye/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-09-05 Deposition Author(s): Brunzelle, J. , Dewdney, T.G. , Kovari, I.A. , Kovari, L.C. , Reiter, S.J. , Wang, Y.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.27 Å
Mdr 769 hiv-1 protease in complex with reduced p1f
Brunzelle, J. , Dewdney, T.G. , Kovari, I.A. , Kovari, L.C. , Reiter, S.J. , Wang, Y.
Primary Citation of Related Structures: 4GYE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWKRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF |
| Protease | B | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWKRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF |
| P1F peptide | C | 6 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RVXEAL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2012-09-05 Deposition Author(s): Brunzelle, J. , Dewdney, T.G. , Kovari, I.A. , Kovari, L.C. , Reiter, S.J. , Wang, Y.