Tyk2 (jh1) in complex with adenosine di-phosphate
PDB DOI: 10.2210/pdb4gvj/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2012-08-30 Deposition Author(s): Abbema, A.V. , Bao, L. , Barrett, K. , Beresini, M. , Berezhkovskiy, L. , Blair, W. , Chang, C. , Driscoll, J. , Eigenbrot, C. , Ghilardi, N. , Gibbons, P. , Halladay, J. , Johnson, A. , Kohli, P.B. , Lai, Y. , Liang, J. , Liimatta, M. , Magnuson, S. , Mantik, P. , Menghrajani, K. , Murray, J. , Sambrone, A. , Shao, Y. , Shia, S. , Shin, Y. , Smith, J. , Sohn, S. , Stanley, M. , Tsui, V. , Ultsch, M. , Wu, L. , Zhang, B.
Tyk2 (jh1) in complex with adenosine di-phosphate
Abbema, A.V. , Bao, L. , Barrett, K. , Beresini, M. , Berezhkovskiy, L. , Blair, W. , Chang, C. , Driscoll, J. , Eigenbrot, C. , Ghilardi, N. , Gibbons, P. , Halladay, J. , Johnson, A. , Kohli, P.B. , Lai, Y. , Liang, J. , Liimatta, M. , Magnuson, S. , Mantik, P. , Menghrajani, K. , Murray, J. , Sambrone, A. , Shao, Y. , Shia, S. , Shin, Y. , Smith, J. , Sohn, S. , Stanley, M. , Tsui, V. , Ultsch, M. , Wu, L. , Zhang, B.
Primary Citation of Related Structures: 4GVJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Non-receptor tyrosine-protein kinase TYK2 | A | 302 | Homo Sapiens | MGSPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADAGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDAGAASLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPAEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYRHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-08-30 Deposition Author(s): Abbema, A.V. , Bao, L. , Barrett, K. , Beresini, M. , Berezhkovskiy, L. , Blair, W. , Chang, C. , Driscoll, J. , Eigenbrot, C. , Ghilardi, N. , Gibbons, P. , Halladay, J. , Johnson, A. , Kohli, P.B. , Lai, Y. , Liang, J. , Liimatta, M. , Magnuson, S. , Mantik, P. , Menghrajani, K. , Murray, J. , Sambrone, A. , Shao, Y. , Shia, S. , Shin, Y. , Smith, J. , Sohn, S. , Stanley, M. , Tsui, V. , Ultsch, M. , Wu, L. , Zhang, B.