Sulfotransferase domain from the synechococcus pcc 7002 olefin synthase
PDB DOI: 10.2210/pdb4gox/pdb
Classification: TRANSFERASE Organism(s): Synechococcus Sp.
Deposited: 2012-08-20 Deposition Author(s): Mccarthy, J.G. , Smith, J.L.
Sulfotransferase domain from the synechococcus pcc 7002 olefin synthase
Primary Citation of Related Structures: 4GOX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Polyketide synthase | A | 313 | Synechococcus Sp. | SNASQSLSVKTKKQWQKPDHKNPNPIAFILSSPRSGSTLLRVMLAGHPGLYSPPELHLLPFETMGDRHQELGLSHLGEGLQRALMDLENLTPEASQAKVNQWVKANTPIADIYAYLQRQAEQRLLIDKSPSYGSDRHILDHSEILFDQAKYIHLVRHPYAVIESFTRLRMDKLLGAEQQNPYALAESIWRTSNRNILDLGRTVGADRYLQVIYEDLVRDPRKVLTNICDFLGVDFDEALLNPYSGDRLTDGLHQQSMGVGDPNFLQHKTIDPALADKWRSITLPAALQLDTIQLAETFAYDLPQEPQLTPQTQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-08-20 Deposition Author(s): Mccarthy, J.G. , Smith, J.L.