Crystal structure of the sgta homodimerization domain with a covalent modification of a single c38
PDB DOI: 10.2210/pdb4goe/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2012-08-19 Deposition Author(s): Chartron, J.W. , Clemons Jr., W.M. , Vandervelde, D.G.
Crystal structure of the sgta homodimerization domain with a covalent modification of a single c38
Chartron, J.W. , Clemons Jr., W.M. , Vandervelde, D.G.
Primary Citation of Related Structures: 4GOE
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Small glutamine-rich tetratricopeptide repeat-containing protein alpha | A | 52 | Homo Sapiens | MKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLAL |
Small glutamine-rich tetratricopeptide repeat-containing protein alpha | B | 52 | Homo Sapiens | MKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLAL |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-08-19 Deposition Author(s): Chartron, J.W. , Clemons Jr., W.M. , Vandervelde, D.G.