Ccaat-binding complex from aspergillus nidulans with dna
PDB DOI: 10.2210/pdb4g92/pdb
Classification: Transcription/DNA Organism(s): Paenisporosarcina Sp. Tg-14 , Sphingomonas Sp. Y57 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-07-23 Deposition Author(s): Brakhage, A.A. , Groll, M. , Hortschansky, P. , Huber, E.M. , Scharf, D.H.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Ccaat-binding complex from aspergillus nidulans with dna
Brakhage, A.A. , Groll, M. , Hortschansky, P. , Huber, E.M. , Scharf, D.H.
Primary Citation of Related Structures: 4G92
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
HAPB protein | A | 64 | Paenisporosarcina Sp. Tg-14 , Sphingomonas Sp. Y57 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MESPLYVNAKQFHRILKRRVARQKLEEQLRLTSKGRKPYLHESRHNHAMRRPRGPGGRFLTADE |
Transcription factor HapC (Eurofung) | B | 92 | Paenisporosarcina Sp. Tg-14 , Sphingomonas Sp. Y57 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKEQDRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKTVNGEDILFAMTSLGFENYAEALKIYLSKYRE |
HapE | C | 119 | Paenisporosarcina Sp. Tg-14 , Sphingomonas Sp. Y57 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVPR |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-07-23 Deposition Author(s): Brakhage, A.A. , Groll, M. , Hortschansky, P. , Huber, E.M. , Scharf, D.H.