Structure of the human discs large 1 pdz2 - adenomatous polyposis coli cytoskeletal polarity complex
PDB DOI: 10.2210/pdb4g69/pdb
Classification: MEMBRANE PROTEIN/SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-07-18 Deposition Author(s): Slep, K.C.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Structure of the human discs large 1 pdz2 - adenomatous polyposis coli cytoskeletal polarity complex
Primary Citation of Related Structures: 4G69
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Disks large homolog 1 | A | 100 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTS |
Adenomatous polyposis coli protein | B | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RHSGSYLVTSV |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-07-18 Deposition Author(s): Slep, K.C.