Crystal structure of the ntf2-like domain of human g3bp1
PDB DOI: 10.2210/pdb4fcj/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2012-05-25 Deposition Author(s): Kristensen, O. , Vognsen, T.
Crystal structure of the ntf2-like domain of human g3bp1
Primary Citation of Related Structures: 4FCJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ras GTPase-activating protein-binding protein 1 | A | 142 | Homo Sapiens | GSHMVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFG |
| Ras GTPase-activating protein-binding protein 1 | B | 142 | Homo Sapiens | GSHMVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFG |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-05-25 Deposition Author(s): Kristensen, O. , Vognsen, T.