Crystal structure of the active hiv-1 protease in complex with the products of p1-p6 substrate
PDB DOI: 10.2210/pdb4f76/pdb
Classification: hydrolase/hydrolase product Organism(s): Brucella Melitensis Biovar , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-05-15 Deposition Author(s): Mittal, S. , Nalam, M.N.L. , Schiffer, C.A.
Crystal structure of the active hiv-1 protease in complex with the products of p1-p6 substrate
Mittal, S. , Nalam, M.N.L. , Schiffer, C.A.
Primary Citation of Related Structures: 4F76
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protease | A | 99 | Brucella Melitensis Biovar , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
Protease | B | 99 | Brucella Melitensis Biovar , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
N terminal product of substrate p1-p6 | C | 5 | Brucella Melitensis Biovar , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RPGNF |
C terminal product of substrate p1-p6 | D | 5 | Brucella Melitensis Biovar , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LQSRP |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-05-15 Deposition Author(s): Mittal, S. , Nalam, M.N.L. , Schiffer, C.A.