Crystal structure of ipse/alpha-1 from schistosoma mansoni eggs
PDB DOI: 10.2210/pdb4el6/pdb
Classification: SIGNALING PROTEIN Organism(s): Schistosoma Mansoni
Deposited: 2012-04-10 Deposition Author(s): Bade, S. , Barths, D. , Blindow, S. , Frey, A. , Haas, H. , Madl, T. , Mayerhofer, H. , Meyer, H. , Mueller-Dieckmann, J. , Sattler, M. , Schramm, G. , Tripsianes, K.
Crystal structure of ipse/alpha-1 from schistosoma mansoni eggs
Bade, S. , Barths, D. , Blindow, S. , Frey, A. , Haas, H. , Madl, T. , Mayerhofer, H. , Meyer, H. , Mueller-Dieckmann, J. , Sattler, M. , Schramm, G. , Tripsianes, K.
Primary Citation of Related Structures: 4EL6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| IL-4-inducing protein | A | 106 | Schistosoma Mansoni | GADSCKYCLQLYDETYERGSYIEVYKSVGSLSPPWTPGSVCVPFVNDTKRERPYWYLFDNVNYTGRITGLGHGTCIDDFTKSGFKGISSIKRCIQTKDGKVECINQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-04-10 Deposition Author(s): Bade, S. , Barths, D. , Blindow, S. , Frey, A. , Haas, H. , Madl, T. , Mayerhofer, H. , Meyer, H. , Mueller-Dieckmann, J. , Sattler, M. , Schramm, G. , Tripsianes, K.