Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp
PDB DOI: 10.2210/pdb4ed4/pdb
Classification: TRANSFERASE Organism(s): Mycobacterium Abscessus
Deposited: 2012-03-26 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 4ED4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase | A | 318 | Mycobacterium Abscessus | GPGSMSETVSDWVPTGAVTVRAPGKVNLYLAVGDLRDDGYHELTTVFHAVSLADDVTVRDADVLSIDVVGQGEGTVPTDERNLAWQAAELFADHVGRAPDVSIFINKDIPVAGGMAGGSADAAAVLVAMNELWHAGVPRRDLHHLAAQLGSDVPFALHGGTALGTGRGEQLATVLARNVFHWVFAFADGGLATPQVFKEIDRLRENGDPPRLAEADELLGALAAGDARRLAPLLGNELQAAAVSLNPELRRTLRAGESAGALAGIVSGSGPTCAFLCTSADDAVQVSAELAGAGVCRTVRVASGPVHGAQVIQGRSDG |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-03-26 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)