Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with quinuclidine bph-651 in the s1 site
PDB DOI: 10.2210/pdb4e9z/pdb
Classification: TRANSFERASE/TRANSFERASE INHIBITOR Organism(s): Staphylococcus Aureus
Deposited: 2012-03-21 Deposition Author(s): Lin, F.-Y. , Liu, Y.-L. , Oldfield, E.
Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with quinuclidine bph-651 in the s1 site
Lin, F.-Y. , Liu, Y.-L. , Oldfield, E.
Primary Citation of Related Structures: 4E9Z
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dehydrosqualene synthase | A | 287 | Staphylococcus Aureus | MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKYHRI |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-03-21 Deposition Author(s): Lin, F.-Y. , Liu, Y.-L. , Oldfield, E.