Crystal structure of the mutant f44r bh1408 protein from bacillus halodurans, northeast structural genomics consortium (nesg) target bhr182
PDB DOI: 10.2210/pdb4e0a/pdb
Classification: TRANSFERASE Organism(s): Bacillus Halodurans
Deposited: 2012-03-02 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Hunt, J.F. , Kuzin, A. , Montelione, G.T. , Neely, H. , Northeast Structural Genomics Consortium (Nesg) , Patel, P. , Seetharaman, J. , Tong, L. , Wang, H. , Xiao, R.
Crystal structure of the mutant f44r bh1408 protein from bacillus halodurans, northeast structural genomics consortium (nesg) target bhr182
Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Hunt, J.F. , Kuzin, A. , Montelione, G.T. , Neely, H. , Northeast Structural Genomics Consortium (Nesg) , Patel, P. , Seetharaman, J. , Tong, L. , Wang, H. , Xiao, R.
Primary Citation of Related Structures: 4E0A
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BH1408 protein | A | 164 | Bacillus Halodurans | MIIREATVQDYEEVARLHTQVHEAHVKERGDIFRSNEPTLNPSRFQAAVQGEKSTVLVFVDEREKIGAYSVIHLVQTPLLPTMQQRKTVYISDLCVDETRRGGGIGRLIFEAIISYGKAHQVDAIELDVYDFNDRAKAFYHSLGMRCQKQTMELPLLEHHHHHH |
| BH1408 protein | B | 164 | Bacillus Halodurans | MIIREATVQDYEEVARLHTQVHEAHVKERGDIFRSNEPTLNPSRFQAAVQGEKSTVLVFVDEREKIGAYSVIHLVQTPLLPTMQQRKTVYISDLCVDETRRGGGIGRLIFEAIISYGKAHQVDAIELDVYDFNDRAKAFYHSLGMRCQKQTMELPLLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-03-02 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Everett, J.K. , Hunt, J.F. , Kuzin, A. , Montelione, G.T. , Neely, H. , Northeast Structural Genomics Consortium (Nesg) , Patel, P. , Seetharaman, J. , Tong, L. , Wang, H. , Xiao, R.