Macrocyclic transition-state mimicking hiv-1 protease inhibitors encompassing a tertiary alcohol
PDB DOI: 10.2210/pdb4cpq/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus
Deposited: 2014-02-08 Deposition Author(s): Derosa, M. , Larhed, M. , Motwani, H.V. , Rosenquist, A. , Unge, J. , Vrang, L. , Wallberg, H.
Method: X-RAY DIFFRACTION Resolution: 2.35 Å
Macrocyclic transition-state mimicking hiv-1 protease inhibitors encompassing a tertiary alcohol
Derosa, M. , Larhed, M. , Motwani, H.V. , Rosenquist, A. , Unge, J. , Vrang, L. , Wallberg, H.
Primary Citation of Related Structures: 4CPQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEASE | A | 99 | Human Immunodeficiency Virus | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF |
| PROTEASE | B | 99 | Human Immunodeficiency Virus | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-02-08 Deposition Author(s): Derosa, M. , Larhed, M. , Motwani, H.V. , Rosenquist, A. , Unge, J. , Vrang, L. , Wallberg, H.