Crystal structure of the dna-binding domain of human etv1 complexed with dna
PDB DOI: 10.2210/pdb4bnc/pdb
Classification: DNA BINDING PROTEIN Organism(s): Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-05-14 Deposition Author(s): Allerston, C.K. , Arrowsmith, C.H. , Bountra, C. , Chaikuad, A. , Cooper, C.D.O. , Edwards, A. , Froese, D.S. , Gileadi, O. , Krojer, T. , Vollmar, M. , Von Delft, F.
Crystal structure of the dna-binding domain of human etv1 complexed with dna
Allerston, C.K. , Arrowsmith, C.H. , Bountra, C. , Chaikuad, A. , Cooper, C.D.O. , Edwards, A. , Froese, D.S. , Gileadi, O. , Krojer, T. , Vollmar, M. , Von Delft, F.
Primary Citation of Related Structures: 4BNC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
HUMAN ETV1 | A | 106 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMGPTSQRRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFSDN |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-05-14 Deposition Author(s): Allerston, C.K. , Arrowsmith, C.H. , Bountra, C. , Chaikuad, A. , Cooper, C.D.O. , Edwards, A. , Froese, D.S. , Gileadi, O. , Krojer, T. , Vollmar, M. , Von Delft, F.