Nmr structure of the glycosylated conotoxin cctx from conus consors
PDB DOI: 10.2210/pdb4b1q/pdb
Classification: TOXIN Organism(s): Conus Consors
Deposited: 2012-07-12 Deposition Author(s): Boelens, R. , Favreau, P. , Gerwig, G.J. , Hocking, H.G. , Kamerling, J.P. , Stocklin, R.
Nmr structure of the glycosylated conotoxin cctx from conus consors
Boelens, R. , Favreau, P. , Gerwig, G.J. , Hocking, H.G. , Kamerling, J.P. , Stocklin, R.
Primary Citation of Related Structures: 4B1Q
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CONOTOXIN CCTX | P | 30 | Conus Consors | APWLVPSQITTCCGYNPGTMCPSCMCTNTC |
Method: SOLUTION NMR
Deposited Date: 2012-07-12 Deposition Author(s): Boelens, R. , Favreau, P. , Gerwig, G.J. , Hocking, H.G. , Kamerling, J.P. , Stocklin, R.