Neutron crystallographic structure of the reduced form perdeuterated pyrococcus furiosus rubredoxin to 1.38 angstrom resolution.
PDB DOI: 10.2210/pdb4ar4/pdb
Classification: ELECTRON TRANSPORT Organism(s): Candidate Division Sr1 Bacterium Raac1_Sr1_1
Deposited: 2012-04-20 Deposition Author(s): Blakeley, M.P. , Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mitchell, E.P.
Neutron crystallographic structure of the reduced form perdeuterated pyrococcus furiosus rubredoxin to 1.38 angstrom resolution.
Blakeley, M.P. , Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mitchell, E.P.
Primary Citation of Related Structures: 4AR4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Rubredoxin | A | 54 | Candidate Division Sr1 Bacterium Raac1_Sr1_1 | MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED |
Method: NEUTRON DIFFRACTION
Deposited Date: 2012-04-20 Deposition Author(s): Blakeley, M.P. , Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mitchell, E.P.