Neutron crystallographic structure of the reduced form perdeuterated pyrococcus furiosus rubredoxin to 1.38 angstrom resolution.
PDB DOI: 10.2210/pdb4ar4/pdb
Classification: ELECTRON TRANSPORT Organism(s): Pyrococcus Furiosus (Strain Atcc 43587 / Dsm 3638 / Jcm 8422 / Vc1)
Deposited: 2012-04-20 Deposition Author(s): Blakeley, M.P. , Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mitchell, E.P.
Method: NEUTRON DIFFRACTION Resolution: 1.381 Å
Neutron crystallographic structure of the reduced form perdeuterated pyrococcus furiosus rubredoxin to 1.38 angstrom resolution.
Blakeley, M.P. , Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mitchell, E.P.
Primary Citation of Related Structures: 4AR4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Rubredoxin | A | 54 | Pyrococcus Furiosus (Strain Atcc 43587 / Dsm 3638 / Jcm 8422 / Vc1) | MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED |
Method: NEUTRON DIFFRACTION
Deposited Date: 2012-04-20 Deposition Author(s): Blakeley, M.P. , Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mitchell, E.P.