Zinc bound structure of a novel cold-adapted esterase from an arctic intertidal metagenomic library
PDB DOI: 10.2210/pdb4ao7/pdb
Classification: HYDROLASE Organism(s): Unidentified
Deposited: 2012-03-23 Deposition Author(s): Blencke, H.M. , Fu, J. , Johnson, K.A. , Landfald, B. , Leiros, H.-K.S. , Pascale, D.D.
Zinc bound structure of a novel cold-adapted esterase from an arctic intertidal metagenomic library
Blencke, H.M. , Fu, J. , Johnson, K.A. , Landfald, B. , Leiros, H.-K.S. , Pascale, D.D.
Primary Citation of Related Structures: 4AO7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ESTERASE | A | 259 | Unidentified | MRGSHHHHHHGSMRHQMSWNGKDERKLSVQERGFSLEVDGRTVPGVYWSPAEGSSDRLVLLGHGGTTHKKVEYIEQVAKLLVGRGISAMAIDGPGHGERASVQAGREPTDVVGLDAFPRMWHEGGGTAAVIADWAAALDFIEAEEGPRPTGWWGLSMGTMMGLPVTASDKRIKVALLGLMGVEGVNGEDLVRLAPQVTCPVRYLLQWDDELVSLQSGLELFGKLGTKQKTLHVNPGKHSAVPTWEMFAGTVDYLDQRLK |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-03-23 Deposition Author(s): Blencke, H.M. , Fu, J. , Johnson, K.A. , Landfald, B. , Leiros, H.-K.S. , Pascale, D.D.