Crystal structure of the mutant d75n i-crei in complex with its wild- type target (the four central bases, 2nn region, are composed by gtac from 5' to 3')
PDB DOI: 10.2210/pdb4aab/pdb
Classification: HYDROLASE/DNA Organism(s): Chlamydomonas Reinhardtii , Synthetic Construct
Deposited: 2011-12-01 Deposition Author(s): D'Abramo, M. , Duchateau, P. , Epinat, J.C. , Gervasio, F.L. , Grizot, S. , Marenchino, M. , Molina, R. , Montoya, G. , Prieto, J. , Redondo, P. , Stella, S. , Valton, J.
Crystal structure of the mutant d75n i-crei in complex with its wild- type target (the four central bases, 2nn region, are composed by gtac from 5' to 3')
D'Abramo, M. , Duchateau, P. , Epinat, J.C. , Gervasio, F.L. , Grizot, S. , Marenchino, M. , Molina, R. , Montoya, G. , Prieto, J. , Redondo, P. , Stella, S. , Valton, J.
Primary Citation of Related Structures: 4AAB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA ENDONUCLEASE I-CREI | A | 152 | Chlamydomonas Reinhardtii , Synthetic Construct | NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQRRWFLDKLVDEIGVGYVRDRGSVSNYILSEIKPLHNFLTQLQPFLKLKQKQANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVLD |
| DNA ENDONUCLEASE I-CREI | B | 152 | Chlamydomonas Reinhardtii , Synthetic Construct | NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQRRWFLDKLVDEIGVGYVRDRGSVSNYILSEIKPLHNFLTQLQPFLKLKQKQANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVLD |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 14MER DNA 5'-D(*TP*CP*AP*AP*AP*AP*CP*GP*TP*CP*GP*TP*AP*CP)-3' | d | 14 | NA | TCAAAACGTCGTAC |
| 14MER DNA 5'-D(*TP*CP*AP*AP*AP*AP*CP*GP*TP*CP*GP*TP*AP*CP)-3' | f | 14 | NA | TCAAAACGTCGTAC |
| 10MER DNA 5'-D(*GP*AP*CP*GP*TP*TP*TP*TP*GP*AP)-3' | e | 10 | NA | GACGTTTTGA |
| 10MER DNA 5'-D(*GP*AP*CP*GP*TP*TP*TP*TP*GP*AP)-3' | g | 10 | NA | GACGTTTTGA |
Method: X-RAY DIFFRACTION
Deposited Date: 2011-12-01 Deposition Author(s): D'Abramo, M. , Duchateau, P. , Epinat, J.C. , Gervasio, F.L. , Grizot, S. , Marenchino, M. , Molina, R. , Montoya, G. , Prieto, J. , Redondo, P. , Stella, S. , Valton, J.