Crystal structure of the human vitamin d receptor ligand binding domain complexed with 1-((((1s,2r,6r,z)-2,6-dihydroxy-4-((e)-2-((1r,3as,7ar)-1-((r)-6-hydroxy-6-methylheptan-2-yl)-7a-methylhexahydro-1h-inden-4(2h)-ylidene)ethylidene)-3-methylenecyclohexyl)oxy)methyl)cyclopropanecarbonitrile
PDB DOI: 10.2210/pdb3wwr/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2014-06-27 Deposition Author(s): Kakuda, S. , Takimoto-Kamimura, M.
Method: X-RAY DIFFRACTION Resolution: 3.18 Å
Crystal structure of the human vitamin d receptor ligand binding domain complexed with 1-((((1s,2r,6r,z)-2,6-dihydroxy-4-((e)-2-((1r,3as,7ar)-1-((r)-6-hydroxy-6-methylheptan-2-yl)-7a-methylhexahydro-1h-inden-4(2h)-ylidene)ethylidene)-3-methylenecyclohexyl)oxy)methyl)cyclopropanecarbonitrile
Kakuda, S. , Takimoto-Kamimura, M.
Primary Citation of Related Structures: 3WWR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Vitamin D3 receptor | A | 263 | Homo Sapiens | GSHMDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-06-27 Deposition Author(s): Kakuda, S. , Takimoto-Kamimura, M.