Crystal structure of erp46 trx2 in a complex with prx4 c-term
PDB DOI: 10.2210/pdb3wgx/pdb
Classification: ISOMERASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-08-13 Deposition Author(s): Inaba, K. , Kojima, R. , Suzuki, M.
Crystal structure of erp46 trx2 in a complex with prx4 c-term
Inaba, K. , Kojima, R. , Suzuki, M.
Primary Citation of Related Structures: 3WGX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thioredoxin domain-containing protein 5 | A | 113 | Homo Sapiens , Synthetic Construct | GSHMGLYELSASNFELHVAQGDHFIKFFAPWCGHAKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTE |
| Thioredoxin domain-containing protein 5 | B | 113 | Homo Sapiens , Synthetic Construct | GSHMGLYELSASNFELHVAQGDHFIKFFAPWCGHAKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTE |
| Peroxiredoxin-4 | C | 20 | Homo Sapiens , Synthetic Construct | HGEVCPAGWKPGSETIIPDP |
| Peroxiredoxin-4 | D | 20 | Homo Sapiens , Synthetic Construct | HGEVCPAGWKPGSETIIPDP |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-08-13 Deposition Author(s): Inaba, K. , Kojima, R. , Suzuki, M.