Crystal structure analysis of cyanidioschyzon melorae ferredoxin d58n mutant
PDB DOI: 10.2210/pdb3wcq/pdb
Classification: ELECTRON TRANSPORT Organism(s): Cyanidioschyzon Merolae
Deposited: 2013-05-31 Deposition Author(s): Imai, T. , Matsumoto, T. , Morimoto, Y. , Ueno, Y. , Yamano, A.
Crystal structure analysis of cyanidioschyzon melorae ferredoxin d58n mutant
Imai, T. , Matsumoto, T. , Morimoto, Y. , Ueno, Y. , Yamano, A.
Primary Citation of Related Structures: 3WCQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ferredoxin | A | 97 | Cyanidioschyzon Merolae | MYKIQLVNQKEGIDVTIQCAGDQYILDAAEEQGVDLPYSCRAGACSTCAGKLVKGSVNQSDQSFLDEDQISKGFILTCVAYPTSDCVIQTHQEEALY |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-05-31 Deposition Author(s): Imai, T. , Matsumoto, T. , Morimoto, Y. , Ueno, Y. , Yamano, A.