Crystal structure of methyl cpg binding domain of mbd4 in complex with the 5mcg/tg sequence
PDB DOI: 10.2210/pdb3vxv/pdb
Classification: HYDROLASE/DNA Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2012-09-21 Deposition Author(s): Arita, K. , Ariyoshi, M. , Kato, T. , Kinoshita, M. , Otani, J. , Shirakawa, M.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Crystal structure of methyl cpg binding domain of mbd4 in complex with the 5mcg/tg sequence
Arita, K. , Ariyoshi, M. , Kato, T. , Kinoshita, M. , Otani, J. , Shirakawa, M.
Primary Citation of Related Structures: 3VXV
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Methyl-CpG-binding domain protein 4 | A | 69 | Mus Musculus , Synthetic Construct | SGHKPVPCGWERVVKQRLSGKTAGKFDVYFISPQGLKFRSKRSLANYLLKNGETFLKPEDFNFTVLPKG |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-09-21 Deposition Author(s): Arita, K. , Ariyoshi, M. , Kato, T. , Kinoshita, M. , Otani, J. , Shirakawa, M.