Crystal structure of hiv-1 protease mutant l76v with novel p1'-ligands grl-02031
PDB DOI: 10.2210/pdb3vf7/pdb
Classification: hydrolase/hydrolase inhibitor Organism(s): Human Immunodeficiency Virus Type 1 (Bru Isolate)
Deposited: 2012-01-09 Deposition Author(s): Chang, Y.C.E. , Wang, Y.F. , Weber, I.T. , Yu, X.X.
Crystal structure of hiv-1 protease mutant l76v with novel p1'-ligands grl-02031
Chang, Y.C.E. , Wang, Y.F. , Weber, I.T. , Yu, X.X.
Primary Citation of Related Structures: 3VF7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| protease | A | 99 | Human Immunodeficiency Virus Type 1 (Bru Isolate) | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVVVGPTPVNIIGRNLLTQIGATLNF |
| protease | B | 99 | Human Immunodeficiency Virus Type 1 (Bru Isolate) | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVVVGPTPVNIIGRNLLTQIGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-01-09 Deposition Author(s): Chang, Y.C.E. , Wang, Y.F. , Weber, I.T. , Yu, X.X.