Crystal structure of the get5 carboxyl domain from s. cerevisiae
PDB DOI: 10.2210/pdb3vej/pdb
Classification: PROTEIN BINDING Organism(s): Saccharomyces Cerevisiae
Deposited: 2012-01-08 Deposition Author(s): Chartron, J.W. , Clemons Jr., W.M. , Rao, M. , Vandervelde, D.G.
Crystal structure of the get5 carboxyl domain from s. cerevisiae
Chartron, J.W. , Clemons Jr., W.M. , Rao, M. , Vandervelde, D.G.
Primary Citation of Related Structures: 3VEJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ubiquitin-like protein MDY2 | A | 41 | Saccharomyces Cerevisiae | SVDLTVPWDDIEALLKNNFENDQAAVRQVMERLQKGWSLAK |
Ubiquitin-like protein MDY2 | B | 41 | Saccharomyces Cerevisiae | SVDLTVPWDDIEALLKNNFENDQAAVRQVMERLQKGWSLAK |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-01-08 Deposition Author(s): Chartron, J.W. , Clemons Jr., W.M. , Rao, M. , Vandervelde, D.G.